Protein coding transcript 129706

• Transcript: Ll_transcript_432386
• CDS coordinates: 2-412 (+)
• Peptide sequence: YIRKGVYHEYVEVTKQMTHVVFVGDGRNKTRITGNKNFMDGINTYRTSTVVIEGDYFVAMNMGFENSAGPHKHQAVAIRVQSDKSIFYKCSFDGYQDTLYAHTHRQFYRDCTISGTIDFIFGDAIAVFQNCTFILRK
• ORF Type: internal

Annotations of Ll_transcript_432386

• Blastp: Probable pectinesterase/pectinesterase inhibitor 21 from Arabidopsis with 70.07% of identity
• Blastx: Probable pectinesterase/pectinesterase inhibitor 21 from Arabidopsis with 70.07% of identity
• Eggnog: pectinesterase(COG4677)
• Kegg: Link to kegg annotations (AT3G05610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451475.1)
• Pfam: Pectinesterase (PF01095.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;