Transcript | Ll_transcript_432422 |
---|---|
CDS coordinates | 3-344 (+) |
Peptide sequence | LFTDLLGDPICRVRHSPAFLMLVAEIGDEIIGMIRGCIKTVTCGKKLSRNEKYKHFTTTTNNNNSCNDTVQSITPKHVPVYTKVAYILGLRVSPSYRRMRVGMKLVQRMESWFK |
ORF Type | internal |
Blastp | Probable N-acetyltransferase HLS1 from Arabidopsis with 58.97% of identity |
---|---|
Blastx | Probable N-acetyltransferase HLS1 from Arabidopsis with 58.97% of identity |
Eggnog | Acetyltransferase (GNAT) family(ENOG410YF8W) |
Kegg | Link to kegg annotations (AT4G37580) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444962.1) |
Pfam | Acetyltransferase (GNAT) family (PF00583.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer