Protein coding transcript 129711

• Transcript: Ll_transcript_277481
• CDS coordinates: 1-312 (+)
• Peptide sequence: SQHGIKFQFEIFKTKTKGWGVRSLNTIPSGSFICEYTGKLLEDAEAEQNIGQDEYLFDIGNNYVDSSLCEELLKIMPDAADSSSSEVFEDGGFTIDAANYGNVG
• ORF Type: internal

Annotations of Ll_transcript_277481

• Blastp: Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6 from Arabidopsis with 61.9% of identity
• Blastx: Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6 from Arabidopsis with 61.9% of identity
• Eggnog: Histone-lysine N-methyltransferase(COG2940)
• Kegg: Link to kegg annotations (AT2G22740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019465146.1)
• Pfam: SET domain (PF00856.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;