Transcript | Ll_transcript_294027 |
---|---|
CDS coordinates | 3-398 (+) |
Peptide sequence | MAGYYGAPQPMNQFTDPNNTTVFVGGLSGYVTEDELRSFFQGFGEITYVKIPPGKGCGFVQFVQRHAAEMAINQMQGYPIGNSRVRLSWGRSQNNSGPAGTPYRPAPPPPVYPTMGMPPQHNPYGNFAPRQ* |
ORF Type | complete |
Blastp | - |
---|---|
Blastx | Uncharacterized RNA-binding protein C23E6.01c from Schizosaccharomyces with 71.74% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (SPBC23E6.01c) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419411.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer