| Transcript | Ll_transcript_294027 |
|---|---|
| CDS coordinates | 3-398 (+) |
| Peptide sequence | MAGYYGAPQPMNQFTDPNNTTVFVGGLSGYVTEDELRSFFQGFGEITYVKIPPGKGCGFVQFVQRHAAEMAINQMQGYPIGNSRVRLSWGRSQNNSGPAGTPYRPAPPPPVYPTMGMPPQHNPYGNFAPRQ* |
| ORF Type | complete |
| Blastp | - |
|---|---|
| Blastx | Uncharacterized RNA-binding protein C23E6.01c from Schizosaccharomyces with 71.74% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (SPBC23E6.01c) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019419411.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer