| Transcript | Ll_transcript_239404 |
|---|---|
| CDS coordinates | 1-297 (+) |
| Peptide sequence | QSVETKVGQVTKAVTDAPIYQKTTSVIGGITGSITNKFGQMRHSESFRSIEERVGSAYENVKTKVVSRSNSTQSLDDAARSRSGSVVTSPTIPEEKPLA |
| ORF Type | internal |
| Blastp | Uncharacterized protein F13E6.1 from Caenorhabditis with 34.74% of identity |
|---|---|
| Blastx | Uncharacterized protein F13E6.1 from Caenorhabditis with 34.74% of identity |
| Eggnog | tumor protein(ENOG4111M9H) |
| Kegg | Link to kegg annotations (CELE_F13E6.1) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_020214273.1) |
| Pfam | Tumour protein D52 family (PF04201.14) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer