Protein coding transcript 129822

• Transcript: Ll_transcript_275855
• CDS coordinates: 1-363 (-)
• Peptide sequence: MSSTSKLNDKTNQPATLPPPAQPQKWPAGMLKMDMLTSELRVQGRLALPMVVMNLAWFGKTAITTAFLGRLGELSLAGGALGFTFANVTGFSVLNGLCGAMEAICGQAQGAQNIKLLHKTL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_275855

• Blastp: Protein DETOXIFICATION 56 from Arabidopsis with 67.42% of identity
• Blastx: Protein DETOXIFICATION 56 from Arabidopsis with 67.42% of identity
• Eggnog: Mate efflux family protein(COG0534)
• Kegg: Link to kegg annotations (AT4G22790)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421674.1)
• Pfam: MatE (PF01554.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;