Protein coding transcript 129828

• Transcript: Ll_transcript_70494
• CDS coordinates: 1-300 (+)
• Peptide sequence: RLVLPMGHKAGMPFSLFVMVTPYGAAEETAQYYGQNTGVQNFQSCNGLTAALDNQPLGFPFDREIVDFNQFFTPNMYFKDVSIYQKSSQQVHQGNNLPA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_70494

• Blastp: Larval serum protein 1 alpha chain from Sophophora with 44.57% of identity
• Blastx: Larval serum protein 1 alpha chain from Sophophora with 44.57% of identity
• Eggnog: Larval storage protein (LSP) which may serve as a store of amino acids for synthesis of adult proteins(ENOG410XR2D)
• Kegg: Link to kegg annotations (Dmel_CG2559)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003610665.1)
• Pfam: Hemocyanin, ig-like domain (PF03723.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;