Protein coding transcript 129829

• Transcript: Ll_transcript_70490
• CDS coordinates: 1-330 (+)
• Peptide sequence: VKLSAIDRLMSTGSLNIEIIVNNKSLDKGLNVIQLETAVGAAMKSFDGGLGINVPRRRFLPVKKTSDLLLVMSNLYSLQNGSLVMNPERMFFTTPLVKLGDNHFAKVKEF
• ORF Type: internal

Annotations of Ll_transcript_70490

• Blastp: UTP--glucose-1-phosphate uridylyltransferase from Homo with 65.45% of identity
• Blastx: UTP--glucose-1-phosphate uridylyltransferase from Homo with 65.45% of identity
• Eggnog: pyrophosphorylase(COG4284)
• Kegg: Link to kegg annotations (7360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016190331.1)
• Pfam: UTP--glucose-1-phosphate uridylyltransferase (PF01704.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;