Protein coding transcript 129832

• Transcript: Ll_transcript_151162
• CDS coordinates: 3-302 (+)
• Peptide sequence: TGDQVYKSVFIIFFQGDQLKTRVKKICEGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRHRVLVAAAKNIKNWFIKVRKIKAIYHTLNLF
• ORF Type: internal

Annotations of Ll_transcript_151162

• Blastp: Probable V-type proton ATPase 116 kDa subunit a from Caenorhabditis with 81% of identity
• Blastx: Probable V-type proton ATPase 116 kDa subunit a from Caenorhabditis with 81% of identity
• Eggnog: ATPase 116 kDa subunit(COG1269)
• Kegg: Link to kegg annotations (CELE_ZK637.8)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014621551.1)
• Pfam: V-type ATPase 116kDa subunit family (PF01496.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;