Protein coding transcript 129937

• Transcript: Ll_transcript_243485
• CDS coordinates: 1-408 (+)
• Peptide sequence: VNSCVPYIASHFIGAIPSCIAIDYPIEDKNKLVKILEPKVIFTLPEHVDEMRNICMLWNLRAKFVVFGEYKEETRFEDVNQPNPNEDKFEPVEIKNLKDTAIMYFSSGTTGLPKAICLNHFSMLINLIKDKNTENP
• ORF Type: internal

Annotations of Ll_transcript_243485

• Blastp: Probable 4-coumarate--CoA ligase 3 from Dictyostelium with 26.95% of identity
• Blastx: Probable 4-coumarate--CoA ligase 3 from Dictyostelium with 26.95% of identity
• Eggnog: Amp-dependent synthetase and ligase(COG0318)
• Kegg: Link to kegg annotations (DDB_G0284743)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017423816.1)
• Pfam: AMP-binding enzyme (PF00501.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;