Protein coding transcript 129940

• Transcript: Ll_transcript_247447
• CDS coordinates: 55-429 (+)
• Peptide sequence: MLALIGIVENRNTKNKKTKTTEAAETASLELKRRNDELEEELRKSKEREEQIQRQLHAVWERLRVAEEAEERLCTQLGDLEAEGVHQARQYHARIVSLMEQLSHTNSLLNNNIKASSISVPLSS*
• ORF Type: complete

Annotations of Ll_transcript_247447

• Blastp: Protein RESPONSE TO LOW SULFUR 2 from Arabidopsis with 47.44% of identity
• Blastx: -
• Eggnog: NA(ENOG410ZF0Z)
• Kegg: Link to kegg annotations (AT5G24660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418430.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;