Protein coding transcript 129942

• Transcript: Ll_transcript_247451
• CDS coordinates: 1-405 (+)
• Peptide sequence: AVDWWALGVLSYEMLYGTTPFKGKNRKETYRNVLYKEPVFLGKKTALTDLIERLLEKDPVKRLGYVRGGSEIKEHEFFKGVKWDLLTEVVRPPFIPSRDADVDGVGEDIREYFQKLKSPPLSSPESQNVSFAEF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_247451

• Blastp: Serine/threonine-protein kinase UCN from Arabidopsis with 64.79% of identity
• Blastx: Serine/threonine-protein kinase UCN from Arabidopsis with 67.5% of identity
• Eggnog: serine threonine-protein kinase(ENOG410XQ0C)
• Kegg: Link to kegg annotations (AT1G51170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436579.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;