Protein coding transcript 130983

• Transcript: Ll_transcript_169948
• CDS coordinates: 1-708 (+)
• Peptide sequence: EQGVTAYWRGNMANVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKAGAGREFSGLGDCLSKVFKSDGITGLYKGFGVSVQGIIIYRASYFGCFDTAKGMLPDPKSAGFLLSWAIAQVVTTVAGIMSYPFDTVRRRMMMQSGRAKSEIVYKSTLHCWSVIAKTEGAGAFFKGAFSNVLRGTGGALVLVLYDEIKTLL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_169948

• Blastp: ADP,ATP carrier protein from Sophophora with 82.98% of identity
• Blastx: ADP,ATP carrier protein 2 from Anopheles with 83.4% of identity
• Eggnog: transmembrane transport(ENOG410XNW0)
• Kegg: Link to kegg annotations (Dmel_CG16944)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003603158.1)
• Pfam: Mitochondrial carrier protein (PF00153.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;