Transcript | Ll_transcript_169923 |
---|---|
CDS coordinates | 349-1119 (+) |
Peptide sequence | MVMMKHMFFALPLVLVICCYSTTILAQSPAAAPAAPDEALAPSTPPTDIIRILQKAGGFTTLIRLLKITQVSTQINSQLLNSNGGLTFFAPNDNAFSSLKPGLLNSLNDQQKNELIQFHLLPTFVSTTDFATLSNPVRTQAGENPDRLALNVTSSGNQVNFTTGIVNATLGGTVYTDHQLAVYQVDKVLLPRDFFVAKTPAPAPAPEKTKASKKKSAEGPAVPAADDDSAAVTVKQFNGMFVSIAATIVAVATFLL* |
ORF Type | complete |
Blastp | Fasciclin-like arabinogalactan protein 11 from Arabidopsis with 56.19% of identity |
---|---|
Blastx | Fasciclin-like arabinogalactan protein 11 from Arabidopsis with 62.5% of identity |
Eggnog | Arabinogalactan protein(ENOG410YFHZ) |
Kegg | Link to kegg annotations (AT5G03170) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448724.1) |
Pfam | Fasciclin domain (PF02469.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer