Protein coding transcript 131048

• Transcript: Ll_transcript_190877
• CDS coordinates: 1-657 (+)
• Peptide sequence: QESVTANFLLPGGQDSNSVNAQQEVVDGSKSGATSPTVTSTVRPKITSTAPSVKPLFGSNTRAIVWGMQTRAVQSMLDFDFVCRRHEPSVACLVYPFTGDHKLKFYWGHKEVLIPVYKRMEDAMLKHQNADVLVNFASLRSAYDSTIETLNYPQIRTIAIIAEGIPENMTRKLILLANEKKVTVIGPATVGGLKPGGFKIGNTGGMMDNILHSKLYRAG
• ORF Type: internal

Annotations of Ll_transcript_190877

• Blastp: ATP-citrate synthase from Mus with 65.58% of identity
• Blastx: ATP-citrate synthase from Mus with 65.58% of identity
• Eggnog: Succinyl-CoA synthetase subunit beta(COG0045)
• Kegg: Link to kegg annotations (104112)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020228450.1)
• Pfam: CoA binding domain (PF02629.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;