Protein coding transcript 131265

• Transcript: Ll_transcript_190879
• CDS coordinates: 3-350 (+)
• Peptide sequence: TILQFYIFGRPPPYFFILVPFSHVPDPQENTSMGGDFGQLKTDIRGVVTTKLSPFEQKAFKGLFSHGIPNSIKRTASNIPYIVPPMIVGYIVYDWAVHAHHESLRKNPADFANDK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_190879

• Blastp: Cytochrome b-c1 complex subunit 8 from Mus with 48.19% of identity
• Blastx: Cytochrome b-c1 complex subunit 8 from Mus with 48.19% of identity
• Eggnog: Ubiquinol-cytochrome c reductase complex(ENOG41123BH)
• Kegg: Link to kegg annotations (22272)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004490590.1)
• Pfam: UcrQ family (PF02939.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;