| Transcript | Ll_transcript_444592 |
|---|---|
| CDS coordinates | 26-871 (+) |
| Peptide sequence | MEKTNRTVRNQVTVVQPLPRLVRSNSGSSSALITTSDKSSRRFSTSERVINSHRSKSTSRVRTGNYEDKKSKDSFGKFLQRGVSPDNNNIGASKRITSTVKSPSAWALSPGRSLGPPIVSEPVKKASGSGGRVGGGVSKVLKYFKQKKMSSAQVDEYHRFKVLHNRVLQWRFINARAEIATATVNNVAKIQLFSVWIRVIMLRKMITQKRIEVQKVKHMIKLYLIMNPQLSLLNEWAKLERRNQESIARLTNKLSALSITLPLTHNLTVYIILDYGYGNIYA |
| ORF Type | 3prime_partial |
| Blastp | QWRF motif-containing protein 7 from Arabidopsis with 37.78% of identity |
|---|---|
| Blastx | QWRF motif-containing protein 7 from Arabidopsis with 36.7% of identity |
| Eggnog | Family of unknown function (DUF566)(ENOG410YP4H) |
| Kegg | Link to kegg annotations (AT4G25190) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019431044.1) |
| Pfam | QWRF family (PF04484.11) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer