Protein coding transcript 134435

• Transcript: Ll_transcript_176391
• CDS coordinates: 35-550 (+)
• Peptide sequence: MGFPVGYTQVFFPNLFLHILIFLGFLRNLVFILFHYLGLSDLLETDVVWPEPNRIPDTKKSPSLSATLIRDLLPIMQFSDLGLTAASVTAAESGCAVCLYEFSGEDEIRCLRNCKHIFHRACVDRWIDHDQKTCPLCRTPFVPDEMVDDYNQRLWAASGVAEFYAEYSTSF*
• ORF Type: complete

Annotations of Ll_transcript_176391

• Blastp: E3 ubiquitin-protein ligase RHA1B from Arabidopsis with 37.74% of identity
• Blastx: E3 ubiquitin-protein ligase RHA1B from Arabidopsis with 37.74% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT4G11360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459561.1)
• Pfam: Anaphase-promoting complex subunit 11 RING-H2 finger (PF12861.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;