Protein coding transcript 1389

• Transcript: Ll_transcript_324967
• CDS coordinates: 117-617 (+)
• Peptide sequence: MATPRLEHLTLQAKRMPGNNYNCTPLTPRSRLERLLRERELRKSSRYVHPTEEGNNKEGDQFLSDVEQFCNEEDLSDTSRAFTEEQPFRQRLLVVANRLPVSAVREGVDSYHLEISVGGLVSALLGVKEFDTRWIGWPGVNVNDDAGQEALTKALAEMRCVPVFLDE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_324967

• Blastp: Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 from Arabidopsis with 56.8% of identity
• Blastx: Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 from Arabidopsis with 54.44% of identity
• Eggnog: synthase(COG0380)
• Kegg: Link to kegg annotations (AT1G78580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461331.1)
• Pfam: Glycosyltransferase family 20 (PF00982.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;