Protein coding transcript 13986

• Transcript: Ll_transcript_324171
• CDS coordinates: 2-304 (+)
• Peptide sequence: KIWKLTFNQDTLPGWVMAVAWMVYLIWLCINFKEPSHDTEENHTESQSNDGTELILHQFFLLVYTFYYVLASCKIDLHQALISPSCPNIVVNFGSLDSFF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_324171

• Blastp: SPX domain-containing membrane protein At4g22990 from Arabidopsis with 66% of identity
• Blastx: SPX domain-containing membrane protein At4g22990 from Arabidopsis with 66% of identity
• Eggnog: SPX domain-containing membrane protein(ENOG41101S9)
• Kegg: Link to kegg annotations (AT4G22990)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413723.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;