Protein coding transcript 140

• Transcript: Ll_transcript_444378
• CDS coordinates: 2-376 (+)
• Peptide sequence: VMQVLSRRTKNNPVLIGSAGTGKTAILEGLAQRIIRGDVPESIKNKRVISLDLGSLIAGAKFRGDFEERLKKVLKEVEDAHGGVILFIDELHTLLGLGKAEGSIDASNLLKPALSRGELQCCGAT
• ORF Type: internal

Annotations of Ll_transcript_444378

• Blastp: Heat shock protein 78, mitochondrial from Schizosaccharomyces with 76.8% of identity
• Blastx: Heat shock protein 78, mitochondrial from Schizosaccharomyces with 76.8% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPBC4F6.17c)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014625138.1)
• Pfam: ATPase family associated with various cellular activities (AAA) (PF00004.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;