Transcript | Ll_transcript_108493 |
---|---|
CDS coordinates | 149-1030 (+) |
Peptide sequence | MLRSLQLHSTHRIILTLILSSLLFPFSSILSIHGYPTRANIFIYAGCSQEKYQPNSPFETNLNSFLSSVISSSSQTIYNSFVIGNDSSAASEGSIFGLYQCRGDLQPIDCSKCVARLVNQIGLVCPYTLGAYLQLDGCYIRYEHSDDFLGKVDTSIRYKKCSNTASSDTEFFRRRDDVFAYLESANGFRVSSSGLVQGFAQCFGDLTVSDCTSCIADAVGKLKSLCGPAAAADVFLGQCYARYWASGYYDESGPSHDDQVGKSVAIIVGVFAGLAILVILLSICKKSMGKSFS* |
ORF Type | complete |
Blastp | Cysteine-rich repeat secretory protein 15 from Arabidopsis with 62.35% of identity |
---|---|
Blastx | Cysteine-rich repeat secretory protein 15 from Arabidopsis with 62.35% of identity |
Eggnog | cysteine-rich repeat secretory protein(ENOG410YAWB) |
Kegg | Link to kegg annotations (AT3G60720) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460185.1) |
Pfam | Salt stress response/antifungal (PF01657.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer