Protein coding transcript 1464

• Transcript: Ll_transcript_329116
• CDS coordinates: 66-491 (+)
• Peptide sequence: MGGHSPCASCKLLRRRCTQDCIFAPYFPSNDPQKFAMVHKVFGASNVSKMLQELPIQQRADAVSSLVYEANARVRDPVYGCVGAISYLQNMVSELQMQLAVAQTEILCVQMQHEPMMPNTEFEPMIPQYLNDYASSSNVIHE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_329116

• Blastp: LOB domain-containing protein 12 from Arabidopsis with 84.35% of identity
• Blastx: LOB domain-containing protein 12 from Arabidopsis with 84.35% of identity
• Eggnog: LOB domain-containing protein(ENOG410YM9V)
• Kegg: Link to kegg annotations (AT2G30130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416824.1)
• Pfam: Lateral organ boundaries (LOB) domain (PF03195.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;