| Transcript | Ll_transcript_427020 |
|---|---|
| CDS coordinates | 1-522 (+) |
| Peptide sequence | NNWAWSNLTNVVWVEQPAGTGFSHVGSDGAPKDEVEAAAQFLGFFKNFMDTFALQGRKVYIAGESYAGYYVPYIADAMHNASDTTYYNLDSIMIYDPSVSYDAVTNEIPSVPFADYRSGLFSFNDTFMEHLHNKWESCGYADFYQEAMTFPPKGVLPDPPNVGANVTGCSLWEE |
| ORF Type | internal |
| Blastp | - |
|---|---|
| Blastx | Probable serine carboxypeptidase ARB_06414 from Trichophyton with 45.65% of identity |
| Eggnog | carboxy-peptidase(COG2939) |
| Kegg | Link to kegg annotations (ARB_06414) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_013459235.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer