Protein coding transcript 148300

• Transcript: Ll_transcript_173325
• CDS coordinates: 117-917 (+)
• Peptide sequence: MVVSTVLFISGVTTLLHTTFGSRLPLVQGPSFVYLAPVLAIINSPEFQGLNQNKFKHTMKELQGAIIIGSAFQALLGYTGLMSLLVRLINPVVVSPTIAAVGLSFFSYGFPIVGTCLEIGAVQILVVIVFSLYLRKISVLGHRIFLIYAVPLGLAITWAFAFLLTEAGAYSYKGCDINIPASDMLSEHCRKHVSRMKHCRIDTSHALKSSPWFRFPYPLQWGTPVFNWKMAIVMCTVSLISSVDSLENKQVACCHLNNVQCKWYHM*
• ORF Type: complete

Annotations of Ll_transcript_173325

• Blastp: Nucleobase-ascorbate transporter 12 from Arabidopsis with 79.27% of identity
• Blastx: Nucleobase-ascorbate transporter 12 from Arabidopsis with 78.09% of identity
• Eggnog: permease(COG2233)
• Kegg: Link to kegg annotations (AT2G27810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458402.1)
• Pfam: Permease family (PF00860.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;