Protein coding transcript 152

• Transcript: Ll_transcript_357225
• CDS coordinates: 2-349 (+)
• Peptide sequence: EQAQHEEDDVRANEIVPQDACHDKYCGAGKVCQVSAAGEAECVCIATCPVEVDPRRKVCSNHNETWGSDCEVYQMRCMCDHGSEMCRGEKYKHVHIEYYGVCREMRDCSPEDMADF
• ORF Type: internal

Annotations of Ll_transcript_357225

• Blastp: SPARC from Caenorhabditis with 42% of identity
• Blastx: SPARC from Caenorhabditis with 42% of identity
• Eggnog: secreted protein, acidic, cysteine-rich (osteonectin)(ENOG41101WW)
• Kegg: Link to kegg annotations (CELE_C44B12.2)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416156.1)
• Pfam: Kazal-type serine protease inhibitor domain (PF07648.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;