Protein coding transcript 154

• Transcript: Ll_transcript_395186
• CDS coordinates: 1-381 (+)
• Peptide sequence: IDIDFEKEPLGHAADGKPVFLNDIWPTRSDIQAVESKHVIPAMFQEVYARIETGSQSWQKLSAPESTLYPWDEASTYIKKPPFFEGMSKNLPPFVPIESANCLLLLGDSVTTDHISPAGSIARNSPA
• ORF Type: internal

Annotations of Ll_transcript_395186

• Blastp: Cytoplasmic aconitate hydratase from Mus with 64.57% of identity
• Blastx: Cytoplasmic aconitate hydratase from Mus with 64.57% of identity
• Eggnog: aconitate hydratase(COG1048)
• Kegg: Link to kegg annotations (11428)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013453566.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;