Transcript | Ll_transcript_228198 |
---|---|
CDS coordinates | 2147-2446 (+) |
Peptide sequence | MTPIKKSQPSAHQAFVGNWKPNKNDTLENRVPGFGITMNILYGEGVCGQGDVDQMNNIISHYLYYLDLLGVGREQAGAHEVVSCAEQKAFNPITKASSS* |
ORF Type | complete |
Blastp | Chitinase-like protein 1 from Arabidopsis with 71.28% of identity |
---|---|
Blastx | Chitinase-like protein 1 from Arabidopsis with 75.94% of identity |
Eggnog | chitinase(COG3979) |
Kegg | Link to kegg annotations (AT1G05850) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419595.1) |
Pfam | Chitinase class I (PF00182.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer