Transcript | Ll_transcript_452826 |
---|---|
CDS coordinates | 41-346 (+) |
Peptide sequence | MLALSLTFMLDMADSTQMLPAANSVCERIFEYFPYCLGFLVGDPNFGRPSKRCCQHVEKLNILAKHRIGPRFICWCIQLMVTGVTPSLDPSKIQDLPPMCNT |
ORF Type | 3prime_partial |
Blastp | Non-specific lipid-transfer protein 13 from Arabidopsis with 43.01% of identity |
---|---|
Blastx | Non-specific lipid-transfer protein 13 from Arabidopsis with 43.01% of identity |
Eggnog | NA(ENOG41119GQ) |
Kegg | Link to kegg annotations (AT5G44265) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003539533.2) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer