Protein coding transcript 157

• Transcript: Ll_transcript_395191
• CDS coordinates: 3-800 (+)
• Peptide sequence: EASGAFFVFGDSLVDSGNNNYLPTTARADSFPYGIDYPSHRPTGRFSNGFNLADLISQRIGSEAPSPYLSPELTGQKLLVGANFASAGIGILNDTGIQFVGILRIFKQLALFQQYQQRLSAEVGAEKAQQIVKRALVLMTLGGNDFVNNYFLTPFSLRSQQFTIPQFCNYLITEYKKFLLTLHELGARMVLVTGTGPLGCIPSQLARRSKNGECVPELQQAAQIFNALLIQMTKDLNSQLSSYVFVTVNANLMHLDFINNPQRYGF
• ORF Type: internal

Annotations of Ll_transcript_395191

• Blastp: GDSL esterase/lipase At4g28780 from Arabidopsis with 67.67% of identity
• Blastx: GDSL esterase/lipase At4g28780 from Arabidopsis with 67.67% of identity
• Eggnog: GDSL esterase lipase(COG3240)
• Kegg: Link to kegg annotations (AT4G28780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003536954.1)
• Pfam: GDSL-like Lipase/Acylhydrolase (PF00657.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;