Transcript | Ll_transcript_452834 |
---|---|
CDS coordinates | 189-590 (+) |
Peptide sequence | MDFVKKCKMVLGSKKYRYGHHEDTSSSVKYGKLSEKQRPKKKEKPQVAPQGCLAVYVGPERQRFVIKIKHTNHPLFKILLEAAENEYGHRNDGPLWLPCDVDWFYEALVEMECPKDDTGSVGCTFPKGHSRGYS |
ORF Type | 3prime_partial |
Blastp | Auxin-responsive protein SAUR32 from Arabidopsis with 40.66% of identity |
---|---|
Blastx | Auxin-responsive protein SAUR32 from Arabidopsis with 44.29% of identity |
Eggnog | Auxin-induced protein(ENOG410YXA2) |
Kegg | Link to kegg annotations (AT2G46690) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463189.1) |
Pfam | Auxin responsive protein (PF02519.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer