Protein coding transcript 157378

• Transcript: Ll_transcript_233934
• CDS coordinates: 2046-3008 (+)
• Peptide sequence: MVEKASIEDVMKVLLASRKQDMQQLWTTCSHLVAKSGLPPEVLAKHLPIEIVAKIEELRLKSSIARRSMMPHHHHHHHPHDLNAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDNVTPLDILRTLTSDFLFKGAIPGLTHIEPNKLRLCLELVQSAALVLSREEGNANNNPPSSTTTTLPMYHHPMNDDHNSSSSSGNNHNIGNLNLDSRLVYLNLGATVGSGQMSDDHGGRHGDPAMYHHSHHDY*
• ORF Type: complete

Annotations of Ll_transcript_233934

• Blastp: Regulatory protein NPR5 from Arabidopsis with 78.46% of identity
• Blastx: Regulatory protein NPR5 from Arabidopsis with 76.44% of identity
• Eggnog: Ankyrin Repeat(COG0666)
• Kegg: Link to kegg annotations (AT2G41370)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458812.1)
• Pfam: Domain of unknown function (DUF3420) (PF11900.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;