| Transcript | Ll_transcript_396715 |
|---|---|
| CDS coordinates | 35-301 (+) |
| Peptide sequence | MALSVLVTIEMLNAMNSLSENQSLIAMPPWSNLWLVASMALSFTLHFVILHVEVLSTVFQVTPLTGEEWVTVMKFSIPVVLLDETLKFV |
| ORF Type | 3prime_partial |
| Blastp | - |
|---|---|
| Blastx | Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type from Sophophora with 88% of identity |
| Eggnog | P-type atpase(COG0474) |
| Kegg | Link to kegg annotations (Dmel_CG3725) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_020211495.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer