Transcript | Ll_transcript_245371 |
---|---|
CDS coordinates | 16-330 (-) |
Peptide sequence | CWDYRRENIDFFSFFFFETESRSVAQAGVQWHNLGSLQPPPPRFKRFSCLSLLSSWDYRHLPPRPANFCIFSRDGVSPCWPGWSQTPDLLICPSWPPKVLGLQA* |
ORF Type | 5prime_partial |
Blastp | Putative uncharacterized protein encoded by LINC00596 from Homo with 74.29% of identity |
---|---|
Blastx | Putative uncharacterized protein encoded by LINC00596 from Homo with 74.63% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | ptr-mir-1273 (MI0008474) |
Ncbi protein | Link to NCBI protein (XP_004513424.1) |
Pfam | - |
Rfam | Metazoa_SRP (RF00017) |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer