Protein coding transcript 165614

• Transcript: Ll_transcript_128247
• CDS coordinates: 1819-2124 (+)
• Peptide sequence: MPNGSCIELFFPFNVAGMEAVGVVTAVGAGLTGRQVGDLVAYAGQPMGSYAEEQILPANKVVPVPPSIDPVIAASVMLKGMTAQFLLRRCFKVAFYIVYSL*
• ORF Type: complete

Annotations of Ll_transcript_128247

• Blastp: Quinone oxidoreductase from Pseudomonas with 48.05% of identity
• Blastx: Quinone oxidoreductase 1 from Escherichia with 52.04% of identity
• Eggnog: alcohol dehydrogenase(COG0604)
• Kegg: Link to kegg annotations (PA0023)
• CantataDB: Link to cantataDB annotations (CNT0000309)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435326.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;