| Transcript | Ll_transcript_351552 |
|---|---|
| CDS coordinates | 3-317 (+) |
| Peptide sequence | NIRGEFLMKYSIGTPSFDVIAVVDTGCDLIWLQCQPCENCYNQTDPIFDPSKSTTYEIASCSSQACKLVEDSSCKNGTGESKCQYKASYGDASFSIGDVAFETIT |
| ORF Type | internal |
| Blastp | Aspartic proteinase CDR1 from Arabidopsis with 50.49% of identity |
|---|---|
| Blastx | Aspartic proteinase CDR1 from Arabidopsis with 50.49% of identity |
| Eggnog | aspartic(ENOG410XNV7) |
| Kegg | Link to kegg annotations (AT5G33340) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019418605.1) |
| Pfam | Xylanase inhibitor N-terminal (PF14543.5) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer