Protein coding transcript 166250

• Transcript: Ll_transcript_129487
• CDS coordinates: 536-1051 (+)
• Peptide sequence: MKKCSFPCPYYQKVPLSLALSPRIISEVAQFKPDIIHASSPGIMVFGALIIAKLLSVPIVMSYHTHVPVYIPRYTFSWLVKPMWWVIKFLHTAADLTLVPSAAIGRELQAYKVTAANRIRLWNKGVDSDSFHPRYRSDEMRLRLSNGEPEKPLIVHVGRLGFEKSLDFIKR*
• ORF Type: complete

Annotations of Ll_transcript_129487

• Blastp: Sulfoquinovosyl transferase SQD2 from Arabidopsis with 82.53% of identity
• Blastx: Sulfoquinovosyl transferase SQD2 from Arabidopsis with 82.53% of identity
• Eggnog: Glycosyl transferase (Group 1(COG0438)
• Kegg: Link to kegg annotations (AT5G01220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450306.1)
• Pfam: Glycosyltransferase Family 4 (PF13439.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;