| Transcript | Ll_transcript_530986 |
|---|---|
| CDS coordinates | 32-334 (+) |
| Peptide sequence | MSGSEPIKGGKSYAPAPTPQNTPAQNAPISSRAQAPSVSDIKEEDLDRAAAASLFAQNPRLVSMMQNKLSGLVGQSSGYVESLPTPIRRRVDGLKGVQKEH |
| ORF Type | 3prime_partial |
| Blastp | Putative nucleosome assembly protein C2D10.11C from Schizosaccharomyces with 38.64% of identity |
|---|---|
| Blastx | Putative nucleosome assembly protein C2D10.11C from Schizosaccharomyces with 46.94% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (SPBC2D10.11c) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019454979.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer