Protein coding transcript 166382

• Transcript: Ll_transcript_129280
• CDS coordinates: 2342-3247 (+)
• Peptide sequence: MFVPFFHRYNDLRLRIFSKYPDLFPEEVFNIDSFIWSFGILFSRMVRLPSMDGKVALVPWADMLNHSCDVGTYLDYDKSSKGIVFTTDRVYQPGEQVFISYGKKSNGELLLSYGFVPREGANPSDSVELPLSLEKSDESYEQKSELLKKYGLSESQCFPIQITGWPVELMAYAYLAVSPSSLSGKFEEMAAAASNKITNKKDLRYPEIEEQALQFILDSCEFSISKYNKFLQVSGSLDLDVTSPKQLNRRLFLKQLAVDLSTSERRILFRTQYILRRRLRDMRSGELRALKIFDGFRNLFQ*
• ORF Type: complete

Annotations of Ll_transcript_129280

• Blastp: Histone-lysine N-methyltransferase setd3 from Silurana with 27.97% of identity
• Blastx: Histone-lysine N-methyltransferase setd3 from Silurana with 27.97% of identity
• Eggnog: set domain containing(ENOG410Y7DR)
• Kegg: Link to kegg annotations (549331)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420730.1)
• Pfam: SET domain (PF00856.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;