Transcript | Ll_transcript_351576 |
---|---|
CDS coordinates | 1-336 (+) |
Peptide sequence | DLDTYSYRLPLGVCAGIAPFNFPAMVPLWMFPVAITVGNTYIMKPSERDPGACMMLLELLNEAGCPPGVVNAIHGTHDSVNFICDHPDIKAISFVGGDKAGKHIYERGAKNG |
ORF Type | internal |
Blastp | Probable methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial from Anopheles with 77.68% of identity |
---|---|
Blastx | Probable methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial from Anopheles with 77.68% of identity |
Eggnog | Dehydrogenase(ENOG410XNP1) |
Kegg | Link to kegg annotations (AgaP_AGAP002499) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003593285.1) |
Pfam | Aldehyde dehydrogenase family (PF00171.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer