Protein coding transcript 167795

• Transcript: Ll_transcript_179893
• CDS coordinates: 81-587 (+)
• Peptide sequence: MASKVSSSLAIFLTLNILFFALVSSCGTCDQPKQKPKYKPNPGSGGSGGSGGSGGYGGGSHGSGGSGGSGGSGGSGGSGGSSASCPRDTLKLGVCANVLNGLLNVTLGKPPVTPCCTLIQGLADVEAAVCLCTALKANILGINLNLPISLSLLLNVCSKQAPKNFQCA*
• ORF Type: complete

Annotations of Ll_transcript_179893

• Blastp: pEARLI1-like lipid transfer protein 2 from Arabidopsis with 49.45% of identity
• Blastx: 14 kDa proline-rich protein DC2.15 from Daucus sect. Daucus with 67.06% of identity
• Eggnog: 14 kDa proline-rich protein(ENOG410YRRT)
• Kegg: Link to kegg annotations (AT4G12490)
• CantataDB: Link to cantataDB annotations (CNT0000401)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446703.1)
• Pfam: Hydrophobic seed protein (PF14547.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;