Transcript | Ll_transcript_351563 |
---|---|
CDS coordinates | 3-383 (+) |
Peptide sequence | MSSHHAVEGNIKEEPHNTNRAAKGISYFTPAQDPPAGTALVTEETKSVPKLFKPLKLRGLTLNNRIILSPLCQYSAQDGHYTMWHQTHIGGIVQRGPGLACIEATAVTANGRITPEDVGLWKDSQIE |
ORF Type | 3prime_partial |
Blastp | NADPH dehydrogenase afvA from Aspergillus with 62.39% of identity |
---|---|
Blastx | NADPH dehydrogenase afvA from Aspergillus with 62.39% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AFLA_108540) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (NP_001241458.1) |
Pfam | NADH:flavin oxidoreductase / NADH oxidase family (PF00724.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer