Protein coding transcript 168216

• Transcript: Ll_transcript_182337
• CDS coordinates: 202-711 (+)
• Peptide sequence: MKKKCELCNSPATIFCDSDQATLCWNCDSKVHTANFLVARHTRTLLCHTCHSLTPWKASGATIGNAVSLCVGCAGGTRVHGDEGEESEGDNGDELERLDEDGENQVVPLSSTATAPPDCRLFGSEGSVTRCSHGDEDVSDSAMVVSVKRCRVDHDIQVCVIVVFVYFKF*
• ORF Type: complete

Annotations of Ll_transcript_182337

• Blastp: B-box domain protein 30 from Arabidopsis with 54% of identity
• Blastx: B-box domain protein 31 from Arabidopsis with 52.94% of identity
• Eggnog: BBOX(ENOG411168W)
• Kegg: Link to kegg annotations (AT4G15248)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442424.1)
• Pfam: B-box zinc finger (PF00643.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;