Protein coding transcript 1696

• Transcript: Ll_transcript_297660
• CDS coordinates: 22-417 (+)
• Peptide sequence: MQAQKKTKEPLQAVQVFGRKKSATAVAYCRRGKGNLRVNGRPLEMVEPRVLQYKLQEPILLLGKDRFAGVDIRVRVNGGGHVSQIYAIRQAISKALVAYYQKYVDEASKKEMKDVLIQYDRTLLVADPRRCE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_297660

• Blastp: 40S ribosomal protein S16 from Sophophora with 82.95% of identity
• Blastx: 40S ribosomal protein S16 from Sophophora with 82.95% of identity
• Eggnog: 30S ribosomal protein S9(COG0103)
• Kegg: Link to kegg annotations (Dmel_CG4046)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447226.1)
• Pfam: Ribosomal protein S9/S16 (PF00380.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;