| Transcript | Ll_transcript_351536 |
|---|---|
| CDS coordinates | 2-337 (+) |
| Peptide sequence | DYILSTIDIASKMPLEEIVSTLNINGNLHVCAMPDDEFKFKSQSLAGNGASISVNHIGSKKEANAMLKLAAEKGIKTWKQVIPMKDVGKGVQGVKDNSVRYRYVLKQDINA* |
| ORF Type | 5prime_partial |
| Blastp | Probable cinnamyl alcohol dehydrogenase 1 from Nicotiana with 31.43% of identity |
|---|---|
| Blastx | Probable cinnamyl alcohol dehydrogenase 2 from Eucalyptus with 33.33% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (107789450) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019426954.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer