Transcript | Ll_transcript_351540 |
---|---|
CDS coordinates | 33-383 (+) |
Peptide sequence | MLNDWALPKMSDLGVRCAGHEGSGVIVKVGDQVKNLKPGMRAGYKPIQDTCGTCELCRNGNECYCAKAVLTGLMIDGSYKQYIVSPERYTTLVPDGVNDYIAGPIMCSASTIYTSIK |
ORF Type | 3prime_partial |
Blastp | - |
---|---|
Blastx | Alcohol dehydrogenase 1 from Aspergillus with 37.5% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AN8979.2) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020215765.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer