Protein coding transcript 172

• Transcript: Ll_transcript_351528
• CDS coordinates: 103-681 (+)
• Peptide sequence: MATAKRVEIVILCFALACYCVNAGPRIRPIAGPDIYKGQNIAKDSLAPGEKIVNVMNFGAKPDGEFDCTQAFMDAWRAACKSPGQNRLLIPPGRFLVSSMFFAGPCMAPKPITIQVVGTVLATTDISEYENGEWLMFEDIAGLKLIGGGTFDGQGQESWSQTEDCEKSGSTCVRNPSSLYFNKVTNGVIQNIK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_351528

• Blastp: Exopolygalacturonase from Zea with 36.67% of identity
• Blastx: Polygalacturonase from Actinidia with 37.5% of identity
• Eggnog: Glycoside hydrolase family 28(COG5434)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424932.1)
• Pfam: Pectate lyase superfamily protein (PF12708.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;