Transcript | Ll_transcript_351528 |
---|---|
CDS coordinates | 103-681 (+) |
Peptide sequence | MATAKRVEIVILCFALACYCVNAGPRIRPIAGPDIYKGQNIAKDSLAPGEKIVNVMNFGAKPDGEFDCTQAFMDAWRAACKSPGQNRLLIPPGRFLVSSMFFAGPCMAPKPITIQVVGTVLATTDISEYENGEWLMFEDIAGLKLIGGGTFDGQGQESWSQTEDCEKSGSTCVRNPSSLYFNKVTNGVIQNIK |
ORF Type | 3prime_partial |
Blastp | Exopolygalacturonase from Zea with 36.67% of identity |
---|---|
Blastx | Polygalacturonase from Actinidia with 37.5% of identity |
Eggnog | Glycoside hydrolase family 28(COG5434) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424932.1) |
Pfam | Pectate lyase superfamily protein (PF12708.6) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer