Protein coding transcript 174336

• Transcript: Ll_transcript_90877
• CDS coordinates: 2-562 (-)
• Peptide sequence: VLSPIVTKPSTTKFNDLLSDDAKNNNNKGTKPKSRMVTDKDQEHNVKGESRFTDFKSPKGSLKVKIVKEDNASMKEVKNNSSSGGGGRRLRLRVNSPRIRSRKSVSTAAADSSRRSLSDSFAIVKSSFNPERDFRQSMVEMIVHNNIRSSKDLEDLLACYLSLNSDEYHHLIIKVFKQIWFDLIDNH
• ORF Type: internal

Annotations of Ll_transcript_90877

• Blastp: Transcription repressor OFP4 from Arabidopsis with 51.92% of identity
• Blastx: Transcription repressor OFP1 from Arabidopsis with 68.85% of identity
• Eggnog: DUF623 domain containing protein, expressed(ENOG410YV5M)
• Kegg: Link to kegg annotations (AT1G06920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459818.1)
• Pfam: Transcriptional repressor, ovate (PF04844.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;