Protein coding transcript 175857

• Transcript: Ll_transcript_141955
• CDS coordinates: 653-1012 (+)
• Peptide sequence: MQEQRSTIGSLPETIEFDYGSTSSNTTVNPPICLNNMQNPAENRIPDYLLSPAPSEINPSYVNYVNRDWQNINGWRSSGEPSSNNTQKEVNNNEQKRELGCLSSVSANAIGGPILERRFR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_141955

• Blastp: Probable E3 ubiquitin-protein ligase RHG1A from Arabidopsis with 34.95% of identity
• Blastx: Probable E3 ubiquitin-protein ligase RHG1A from Arabidopsis with 34.95% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT5G42940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436946.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;