| Transcript | Ll_transcript_196349 |
|---|---|
| CDS coordinates | 436-789 (+) |
| Peptide sequence | MPSTGLAAPAIAAGLGALAPTLGTLIPVIGASGFAAAAGAAGTIAGSVAVAASFGAAGAGLTGSKMARRVGGVDEFEFKPIGENHNQGVSFYSLIFLFNVVFLTVIVLRSLFLPVIV* |
| ORF Type | complete |
| Blastp | Transmembrane and coiled-coil domain-containing protein 4 from Mus with 50% of identity |
|---|---|
| Blastx | - |
| Eggnog | transmembrane and coiled-coil(ENOG410YB1Z) |
| Kegg | Link to kegg annotations (77056) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019421555.1) |
| Pfam | Protein of unknown function (DUF726) (PF05277.11) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer